PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10031181
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 371aa    MW: 41237.3 Da    PI: 4.3485
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10031181genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.74.7e-071645130
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                     rg+W++ Ed++l   ++++G ++W++ ++ 
      Lus10031181 16 RGPWSPAEDLRLMSFIQKYGHENWRALPKQ 45
                     89***********************98875 PP

2Myb_DNA-binding25.92.3e-081011372248
                      T...........-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  22 g...........tWktIartmgkgRtlkqcksrwqkyl 48 
                      +            W++Ia++++ gRt++++k+ w+++l
      Lus10031181 101 RgwqktgeaqflKWSKIASRLP-GRTDNEIKNVWNTHL 137
                      1566666667778*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-11754IPR009057Homeodomain-like
SuperFamilySSF466899.33E-71145IPR009057Homeodomain-like
PROSITE profilePS500907.89811137IPR017877Myb-like domain
SMARTSM007173.9E-915139IPR001005SANT/Myb domain
PfamPF002491.2E-51644IPR001005SANT/Myb domain
CDDcd001670.008081844No hitNo description
SuperFamilySSF466895.61E-8104142IPR009057Homeodomain-like
PfamPF002493.4E-6113137IPR001005SANT/Myb domain
CDDcd001678.71E-5113137No hitNo description
Gene3DG3DSA:1.10.10.602.6E-12113138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGKGRAPCCD KSQVKRGPWS PAEDLRLMSF IQKYGHENWR ALPKQADSSV FFPEYRRRIP  60
IWAVQIGILS IFVFAVSSRT GNLSNFTVLE FGKRSTEFKN RGWQKTGEAQ FLKWSKIASR  120
LPGRTDNEIK NVWNTHLKKR LSSSLSKNNE LANDSSSPTS SSSSSSLSST TTSLGKKRNS  180
TETETDCQQK QRTKKQRITE EESDDEEDED EEGEIEDGFI NVDELKDESK GISSSSVSSL  240
LVTNSGQIDN VVTVEGQIDS LFELGESAGN LFDDLDFRIS SEPVEDMEFW SLLDGIIGEV  300
STDQQPTGEV VGIGDSDIDM GVQLVDDGVD DNQKWLRYLE TELGLEEINN GGNTDKKNQE  360
DCKVQGIEGN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-33myb domain protein 63